Recombinant Human D (1A) dopamine receptor (DRD1), partial

In Stock
Code CSB-EP007178HU1
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
DRD1; D(1A dopamine receptor; Dopamine D1 receptor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
338-446aa
Target Protein Sequence
RKAFSTLLGCYRLCPATNNAIETVSINNNGAAMFSSHHEPRGSISKECNLVYLIPHAVGSSEDLKKEEAAGIARPLEKLSPALSVILDYDTDVSLEKIQPITQNGQHPT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
17.8 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant Human DRD1 protein expression involves transfecting e.coli cells with a DNA expression vector containing the gene encoding the recombinant protein of interest (338-446aa) and then culturing the cells so that they express the desired protein. The protein features a N-terminal 6xHis tag fusion. The recombinant Human DRD1 protein is collected and purified from the cell lysate through affinity purification. Its purity is greater than 90%, as measured by SDS-PAGE.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
  1. activation of the dopamine D1 receptor on human airway epithelium could induce mucus overproduction, which could worsen airway obstructive symptoms. PMID: 29606146
  2. The promoter region of DRD1 corresponded to positions - 1250 to + 250 in the DNA sequence. The transcription factor-binding sequence was localized. PMID: 30022436
  3. Greater DRD1-related coexpression was associated with lower prefrontal activity and higher working memory performance, indicating greater working memory efficiency. PMID: 29735686
  4. Molecular dynamics simulations show that the interaction of dopamine with the D1 receptor leads to the formation of a hydrogen-bond network with its catechol group and helices 3, 5, and 6, including water molecules. The para hydroxyl group of dopamine binds directly to S5.42 and N6.55, the latter also interacting with S5.43. The formation of this hydrogen-bond network, triggers the opening of the E6.30-R3.60 ionic lock. PMID: 28361444
  5. Two SUMO modification sites existed in dopamine receptor D1, the phosphorylation of which, due to SUMO modification, can interact with PP2A, leading to the inhibition of D1 de-phosphorylation and normal function. PMID: 28770955
  6. Nucleus accumbens dopamine-dopamine receptor signaling regulates sexual preference for females in male mice via Trpc2. PMID: 29241537
  7. Positron emission tomography data showed strong to moderate evidence in favor of failed replications of correlations between D1-R availability and trait social desirability or physical aggression. PMID: 29543812
  8. DR1 induces osteosarcoma cell apoptosis via changes to the MAPK pathway PMID: 28699280
  9. Synonymous SNPs (rs1799914 and rs4867798) of the DRD1 gene were associated with Essential Hypertension in Hani nationality However, none SNPs of DRD1 and DRD3 of best models showed association with Essential Hypertension in Han and Yi nationality. PMID: 28579604
  10. study to identify putative genetic factors in genes of serotonergic and dopaminergic systems modulating the level of manifestation of depressive symptoms in children; a significant interaction effect was detected between rs1039089 in conjunction with rs877138 located upstream of DRD1 and DRD2 genes respectively PMID: 27472173
  11. D1 receptor system is associated with pre-motor inhibition electrophysiological correlates of response inhibition processes PMID: 27021648
  12. DRD1, DRD2 and DRD3 may not be the susceptibility genes for schizophrenia in the Chinese Han population. PMID: 27591410
  13. the D1 receptor exists in several different membrane localizations, depending on the receptor's conformation. PMID: 27570114
  14. D1 receptor is involved in mediating the epileptic effects of Abeta1-42. PMID: 27701029
  15. Signaling of dopamine receptor D1 is regulated by VPS35. PMID: 27460146
  16. The Parkinson's disease-associated LRRK2 mutant G2019S impairs DRD1 internalization, leading to an alteration in signal transduction. The mutant forms of LRRK2 also affect receptor turnover by decreasing the rate of DRD2 trafficking from the Golgi complex to the cell membrane. PMID: 28582422
  17. Here, using PET with [(11)C]raclopride, we identified in the AKT1 gene a new variable number tandem repeat (VNTR) marker associated with baseline striatal dopamine D2/D3 receptor availability and with methylphenidate-induced striatal dopamine increases in healthy volunteers. PMID: 28416594
  18. We explore the role of mothers' executive function in mediating the relation between oxytocin and dopamine gene variants and maternal responsiveness and examined single nucleotide polymorphisms (SNPs) related to the dopamine system DRD1 rs686, DRD1 rs265976,. Dopamine SNPs were not associated with any measure of executive function or parenting (all P > 0.05). PMID: 27620964
  19. DRD1 gene polymorphisms are related to heroin dependence in a Chinese Han population and may be informative for future genetic or biological studies on heroin dependence. PMID: 25966176
  20. Polymorphic mutations in the D2 receptor play a role in dimmer formation with the dopamine D1 receptor. PMID: 28119185
  21. Parkinson's patients carrying allele T at DRD1C62T had an increased risk of visual hallucinations (VHs), expressed as OR (95 % CI, p value), of 10.7 (2.9-40, p = 0.0001). Moreover, patients with DRD1-48 GG and 62TT genotype displayed shorter time to VHs, whereas a longer time to VHs was found in subjects carrying the DRD4 CG alleles PMID: 27497990
  22. DRD1 gene expression reduction in breast cancer patients after spiritual intervention PMID: 26597879
  23. The results of this study showed that Lack of Association Between Polymorphisms in Dopamine Receptor-1 Genes With Childhood Autism in Chinese Han Population. PMID: 26337060
  24. In the dominant model, rs4532 locus of DRD1 gene was related to hypertension with a pooled OR of 1.353 (95% CI =1.016-1.802, P=0.038). [meta-analysis] PMID: 26730182
  25. This study revealed that the factors of schizotypy resembling the negative symptoms of schizophrenia are associated with the minor rs4532/C allele of 4532 SNP on the DRD1 gene. PMID: 26723139
  26. on a sequence learning task in 161 Caucasian participants, the DRD1 polymorphism predicted the ability to learn new sequences PMID: 26419600
  27. the DRD1 gene is implicated in the pathophysiology of psychosis and support the dopamine hypothesis of schizophrenia. PMID: 26957229
  28. No significant association between candidate gene variants and criminal behavior was detected. PMID: 26041607
  29. In penetrating brain injury, carriers of more transcriptionally active DRD1 alleles compared demonstrated greater aggression levels due to medial prefrontal cortex lesions but reduced aggression levels due to lateral prefrontal cortex lesions. PMID: 24618367
  30. Conserved residues in intracellular loop 1 and transmembrane region 2 of DRD1 and DRD5 are essential in ligand binding and signal transduction. PMID: 26186971
  31. D1R and D5R colocalize in renal proximal tubule cells and physically interact in second messenger coupling pathways and heterologous receptor interaction between the two receptors. PMID: 24552847
  32. Dopamine D1 receptor (DRD1) 5' region haplotypes significantly affect transcriptional activity in vitro PMID: 26484506
  33. Polymorphisms in DRD1, DRD2 and GRIN2B confer increased risk of impulse control problems among PD patients. PMID: 25896831
  34. Stress, which in part is mediated by dopamine acting via the D1 receptor, may disrupt normal synaptic plasticity in adolescence resulting in excessive synaptic elimination PMID: 24410560
  35. Dopamine D1 receptor-expressing neurons provide the dominant source of accumbal inhibition to lateral hypothalamus to control over feeding. PMID: 26593092
  36. The observed frequency of dopamine DRD1 and DRD4 polymorphisms is similar to the distribution of these variants in other Caucasian populations PMID: 26665568
  37. D1-like receptors inhibit ROS production by altering PON2 distribution in membrane microdomains in the short-term, and by increasing PON2 expression in the long-term. PMID: 25740199
  38. did not find significant pooled Odds Ratios for any of the six genes, under different models and stratifying for ethnicity. PMID: 25660313
  39. Results suggest that altered splicing of DRD2 and expression of DRD1 may constitute a pathophysiological mechanism in risk for schizophrenia, bipolar and major depressive disorders PMID: 24322206
  40. The GG genotype of rs4532 locus in DRD1 gene was associated with an increased risk of bipolar disorder (Meta-analysis). PMID: 24001587
  41. this work suggests that D1 receptor alters the distribution of Galphas and Galphai3 subunits inside the membrane. PMID: 25527226
  42. Sorting nexin 5 and dopamine d1 receptor regulate the expression of the insulin receptor in human renal proximal tubule cells PMID: 25825816
  43. dopamine receptor is involved in the etiological and cognitive deficits of BD. DRD4 may associate with psychotic symptomatology rather than with a unique diagnosis of BD. DRD1 may associate with cognitive deficits of BD. PMID: 25233244
  44. DRD1 polymorphism predisposes to lung cancer among those exposed to secondhand smoke during childhood. PMID: 25281486
  45. DRD1 polymorphisms may not influence the clinical efficacy of risperidone in Chinese schizophrenia patients. PMID: 25179995
  46. Dopamine D1 receptor activation increases HIV entry into primary human macrophages. PMID: 25268786
  47. LRs are essential not only for the proper membrane distribution and maintenance of AC5/6 activity but also for the regulation of D1R- and D5R-mediated AC signaling. PMID: 25049074
  48. Two rare missense variants in DRD1 were found in patients with tardive-like dystonia. PMID: 24768614
  49. DRD1 might contribute minimally to the emergence of symptoms and cognitive difficulties associated with ADHD in childhood, but may act as a modifier gene of these clinical features and outcome during later development for those with ADHD PMID: 24410775
  50. Constitutive D1R differs from D5R in that it fails to drive expression CRE-regulated genes. Treatment of a D1R line with cis-flupentixol induced up-regulation of Na,K-ATPase-alpha2, NHE-2 and NHE-3 mRNA levels. PMID: 25154512

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, dendritic spine.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Detected in caudate, nucleus accumbens and in the olfactory tubercle.
Database Links

HGNC: 3020

OMIM: 126449

KEGG: hsa:1812

STRING: 9606.ENSP00000327652

UniGene: Hs.2624

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*